PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00003328001
Common NameGSBRNA2T00003328001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family NF-YA
Protein Properties Length: 286aa    MW: 31425.9 Da    PI: 10.0128
Description NF-YA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00003328001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1CBFB_NFYA103.32.2e-32163219158
            CBFB_NFYA   1 deplYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAlrRpRgsgGrF 58 
                          +ep++VNaKQy++Il+RR++Rakle+++kl +ksrkpylheSRh hAl+R+RgsgGrF
  GSBRNA2T00003328001 163 NEPIFVNAKQYHAILRRRKHRAKLEAQNKL-IKSRKPYLHESRHLHALKRARGSGGRF 219
                          59****************************.**************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005211.3E-36161222IPR001289Nuclear transcription factor Y subunit A
PROSITE profilePS5115237.46162222IPR001289Nuclear transcription factor Y subunit A
PfamPF020454.4E-27164219IPR001289Nuclear transcription factor Y subunit A
PRINTSPR006164.5E-23165187IPR001289Nuclear transcription factor Y subunit A
PROSITE patternPS006860167187IPR018362CCAAT-binding factor, conserved site
PRINTSPR006164.5E-23196219IPR001289Nuclear transcription factor Y subunit A
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0016602Cellular ComponentCCAAT-binding factor complex
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 286 aa     Download sequence    Send to blast
MQVFQSKDSS GSTWENSNIQ RSQSFSLTKN MMMMSTTQLP SSMKHSSLQL QNQDSSSTQS  60
TGESGGGEAA SFGEPNRYGC NSIVANTNLS GYNKSTTTSS MVSQEPVFPP TCGPPSWPLQ  120
CAETSHFNGF LASEYASQPT LSHLEMMGLV TSRVPLPHNI QENEPIFVNA KQYHAILRRR  180
KHRAKLEAQN KLIKSRKPYL HESRHLHALK RARGSGGRFL NTKKLQESSN SPLCSSSQMA  240
NGEGYSKSST TPSSSSDRNN MFQNTPFRFS GYPSTHHVSA LMSET*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4awl_A5e-19164224363NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT ALPHA
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Bna.190480.0seed
Cis-element ? help Back to Top
SourceLink
PlantRegMapGSBRNA2T00003328001
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKC7876831e-146KC787683.1 Brassica napus transcription factor subunit NF-YA5A (NF-YA5A) gene, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013640470.10.0PREDICTED: nuclear transcription factor Y subunit A-5-like
RefseqXP_013640471.10.0PREDICTED: nuclear transcription factor Y subunit A-5-like
RefseqXP_013640472.10.0PREDICTED: nuclear transcription factor Y subunit A-5-like
RefseqXP_013640473.10.0PREDICTED: nuclear transcription factor Y subunit A-5-like
SwissprotQ9SYH41e-137NFYA5_ARATH; Nuclear transcription factor Y subunit A-5
TrEMBLA0A078IN830.0A0A078IN83_BRANA; BnaA06g01280D protein
STRINGBra037968.1-P1e-175(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM116331733
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G54160.11e-118nuclear factor Y, subunit A5
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]